PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn040131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 321aa    MW: 33840.4 Da    PI: 9.2247
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn040131genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.38.3e-3971130362
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 e+alkcprC+s+ntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  Achn040131  71 ETALKCPRCESSNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 130
                 7789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3554128IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3273128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.50674128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MNFSSIPAYL DPSNWQQQAP NPQTEGGNGS GSSSQLPQPP PQAPTHGGGP GSIRPGFMAD  60
RARMANIPMP ETALKCPRCE SSNTKFCYFN NYSLTQPRHF CKTCRRYWTR GGALRNVPVG  120
GGCRRNKRSK GGNNSKSPVS GDQQTSSGGN SSSAISSHST GTTSILGLTP QIPSHRFMSP  180
LSQLTEFGSS DMGFNYGISA TSDMNFHLGS SSFLGGNGIP VISPLAGLDL SSGMYPFQGG  240
GLDPSGVYAG GEGGHQFRPR VSAPGLMTQL APVKTEENKE SNIPRQFLGI QGNNDQYWSG  300
TTTAWTDLSG FSSSSTSNHL *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027045.11e-110DNA binding with one finger 2.4, putative
TrEMBLA0A061ET141e-110A0A061ET14_THECC; DNA binding with one finger 2.4, putative
STRINGVIT_08s0007g00180.t012e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-49DNA binding with one finger 2.4